PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn014701
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 225aa    MW: 23531.1 Da    PI: 7.3907
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn014701genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.33.5e-382381361
      zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                 ++l+cprC+stntkfCyynny+lsqPr+fCk+CrryWt+GG+lrnvPvGgg+r+++ +
  Achn014701 23 PEQLPCPRCESTNTKFCYYNNYNLSQPRHFCKSCRRYWTRGGTLRNVPVGGGTRNKNPN 81
                6789**************************************************88754 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-242179IPR003851Zinc finger, Dof-type
PfamPF027013.2E-322579IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9662680IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102864IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0009751Biological Processresponse to salicylic acid
GO:0042545Biological Processcell wall modification
GO:0045787Biological Processpositive regulation of cell cycle
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MPPETSDRRP ARMQNDGAHP PEPEQLPCPR CESTNTKFCY YNNYNLSQPR HFCKSCRRYW  60
TRGGTLRNVP VGGGTRNKNP NKRSRTAAAT SSSSSSSLPD PEPSNPIAMI PGIKIHNTAL  120
PLYADVDLNA NVPEAESYAS FMNPHGGSLF ALGGFGSGFG FGVGAGIWHM EDVSGGNGGG  180
GVGVSGADPG CNTWQVGSGE GGLADVDCFG WPDLAISTPG KGLK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00402DAPTransfer from AT3G50410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0025379e-49AP002537.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0001B06.
GenBankAP0027469e-49AP002746.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0671B11.
GenBankAP0149579e-49AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankCP0126099e-49CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
GenBankGQ1835479e-49GQ183547.1 Oryza sativa Japonica Group Dof-type zinc finger protein 18 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010263782.15e-66PREDICTED: dof zinc finger protein DOF3.4-like
TrEMBLF6H1E93e-64F6H1E9_VITVI; Putative uncharacterized protein
STRINGVIT_18s0001g11310.t018e-64(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45322241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-33DOF zinc finger protein 1